PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v2087990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 136aa    MW: 15394.5 Da    PI: 4.9441
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v2087990.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB148.61.3e-46188895
            NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                     +Pianv+rim+++lP +akis++aket+qecvsefisfvtsea+++cq+e+rkt++++d+lwa+++lGf+dy+ pl+++l++yr++eg
  Lj2g3v2087990.1  1 MPIANVIRIMRRTLPPQAKISDEAKETIQECVSEFISFVTSEANERCQKEQRKTVSAEDVLWAFGKLGFDDYLLPLTLFLHRYRHTEG 88
                     8************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471134.03E-33187IPR009072Histone-fold
PfamPF008083.8E-26163IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.2E-41187IPR009072Histone-fold
PRINTSPR006155.4E-142846No hitNo description
PROSITE patternPS0068503147IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.4E-144765No hitNo description
PRINTSPR006155.4E-146684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MPIANVIRIM RRTLPPQAKI SDEAKETIQE CVSEFISFVT SEANERCQKE QRKTVSAEDV  60
LWAFGKLGFD DYLLPLTLFL HRYRHTEGGL VMPPPPPLPQ PAPGYYYRDD DASASGSSIA  120
PFDSLFHLKR DPDDLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B6e-34185892Transcription factor HapC (Eurofung)
4g91_B6e-34185892Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.120330.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556590.11e-52PREDICTED: nuclear transcription factor Y subunit B-6
SwissprotQ84W661e-48NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A0B2NV021e-52A0A0B2NV02_GLYSO; Nuclear transcription factor Y subunit B-6
TrEMBLI1NCV51e-52I1NCV5_SOYBN; Uncharacterized protein
STRINGGLYMA20G00240.14e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.29e-50nuclear factor Y, subunit B6